PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang09g01250.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 303aa    MW: 32577.5 Da    PI: 9.519
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang09g01250.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.24.3e-1483127347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + ++ G+g+W+ I+r   k+Rt+ q+ s+ qky
   Vang09g01250.1  83 PWTEEEHKLFLVGLQKVGKGDWRGISRNYVKTRTPTQVASHAQKY 127
                      7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.51976132IPR017930Myb domain
SuperFamilySSF466896.5E-1778132IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-1679130IPR006447Myb domain, plants
SMARTSM007174.6E-980130IPR001005SANT/Myb domain
CDDcd001671.28E-983128No hitNo description
Gene3DG3DSA:1.10.10.601.5E-1083127IPR009057Homeodomain-like
PfamPF002492.4E-1183127IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MPLSSASAAA PHSASSAEIM LFGVRVVVDS MRKSVSMNNL SQYDHHRDTA AAKDDAVAAG  60
YASADDAAPN NSGKNRDRKR GIPWTEEEHK LFLVGLQKVG KGDWRGISRN YVKTRTPTQV  120
ASHAQKYFLR RTNLNRRRRR SSLFDITTDS VSCVQVSTTP MEEGQIQYQD NVSLVHPMYP  180
VTPEGSNMNG FSKLPMYSKD IGTGAMSAQA GNPMKILTLG QGNVEQNGPS TKLVCTTAPN  240
IVPDYKGSTA SDITATSLSS LDPPTLSLGL SLSSSQRQTS SIHSAFHSLS CFNNGDSFIT  300
VA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150350.0AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014498253.10.0PREDICTED: transcription factor MYB1R1-like isoform X1
SwissprotQ2V9B06e-65MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLA0A0S3RG910.0A0A0S3RG91_PHAAN; Uncharacterized protein
STRINGGLYMA04G34720.11e-139(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42483154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74840.27e-45MYB_related family protein